DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30008 and CG31523

DIOPT Version :9

Sequence 1:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:261 Identity:81/261 - (31%)
Similarity:129/261 - (49%) Gaps:18/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PVVNVPTIYKDPWYMITVLVLYLYFVTKAGPHFMEWRKPYELKRLILLHNFIQVVSCIYAIKEVL 75
            |.||...:...|...:.:.:.|.||....||..|..|||.||:.:::::|.||.:...:...|  
  Fly    22 PRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYE-- 84

  Fly    76 YITDNTIYIFW-----KCRDIG-SSPELVRRYYNLAYFLFWLKISELIETVIFVLRKKQNQVSKL 134
            |:...    :|     ||:.:. |:..|..|..|:.::.:..|.:|..:|:.|:||||...||.|
  Fly    85 YLMSG----WWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTL 145

  Fly   135 HIFHHFSTVTLVYALINFNENGSAAYFCVFLNSIVHVIMYSYYFVAAVADKTLVQALTPVKKCIT 199
            |:.||......|:..:.|...|.:.:|.: |||.||::||.||.:||:..|  .|.....||.:|
  Fly   146 HVIHHGCMPFSVWMGLKFAPGGHSTFFAL-LNSFVHIVMYFYYMIAAMGPK--YQKYIWWKKYLT 207

  Fly   200 VIQMTQFVLILTQVAFQLVL--CGMPPLVLLYFTTVILGMFYGFYDFYNSAYQASQRRKSQTPQS 262
            ..||.|||.|.|. .|||:.  |..|...:::.....:...:.|.|||.:.|..:.||:.|..::
  Fly   208 TFQMVQFVAIFTH-QFQLLFRECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARRRRQAVKA 271

  Fly   263 D 263
            :
  Fly   272 N 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30008NP_724853.1 ELO 20..257 CDD:279492 77/244 (32%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449627
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
98.900

Return to query results.
Submit another query.