DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and CAM1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:236 Identity:59/236 - (25%)
Similarity:103/236 - (43%) Gaps:46/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVG-GDFHLSETIAIIRYLAD 78
            :.|||...||.....|  .|.|..  ||...::.    .:||||.|| ..:.|:|.:||..||..
Yeast    16 VPRGLVKALKLDVKVV--TPDAAA--EQFARDFP----LKKVPAFVGPKGYKLTEAMAINYYLVK 72

  Fly    79 KGQFDEKLYPKTL---ENRARVDEFLEWQHLN-----IRLACSMYFRDAWLFPMNGIAPKPKPEQ 135
            ..| |:|:..:.|   ::.....:.:.||.|.     |::|.:       :.|:.|.||..| :.
Yeast    73 LSQ-DDKMKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANT-------IVPLKGGAPYNK-KS 128

  Fly   136 IQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSS----EINQLRLCQYRVDEKKFPKVVK 196
            :.:.::.|:..:.:.|.......:|..:|:::||::.:|    ....|...::|.   :.|.:|:
Yeast   129 VDSAMDAVDKIVDIFENRLKNYTYLATENISLADLVAASIFTRYFESLFGTEWRA---QHPAIVR 190

  Fly   197 WLERVRVS---ANPYHDEGLTFID--------RKSKQSTAA 226
            |...||.|   .:.|.|  ..|.|        :|.|::.||
Yeast   191 WFNTVRASPFLKDEYKD--FKFADKPLSPPQKKKEKKAPAA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 22/65 (34%)
GstA 7..202 CDD:223698 48/199 (24%)
GST_C_family 93..218 CDD:295467 29/144 (20%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 22/64 (34%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 29/134 (22%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345029
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.