DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and URE2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:47/213 - (22%)
Similarity:81/213 - (38%) Gaps:73/213 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EQLTDEYKKINRFQKVPAIVG-GDFHLS--ETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLE 102
            |....|:..:|...:|||::. |..:||  |:.||:.:|.:      |.|.:|.......|:..:
Yeast   150 EHRAPEFVSVNPNARVPALIDHGMDNLSIWESGAILLHLVN------KYYKETGNPLLWSDDLAD 208

  Fly   103 WQHLNIRLACSMYFRDAWLF-------PMNGIAPKPKPEQIQALIEGVEN------------NLG 148
            ...:|           ||||       ||.|.|...:....|.:...||.            .:.
Yeast   209 QSQIN-----------AWLFFQTSGHAPMIGQALHFRYFHSQKIASAVERYTDEVRRVYGVVEMA 262

  Fly   149 LLER---LWLEND------------------------FLVGKNLTMADIL---GSSEINQLRLCQ 183
            |.||   |.:|.|                        :|||..||:||:.   .::.::::.: .
Yeast   263 LAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIADLAFVPWNNVVDRIGI-N 326

  Fly   184 YRVDEKKFPKVVKWLERV 201
            .:::   ||:|.||.:.:
Yeast   327 IKIE---FPEVYKWTKHM 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 13/41 (32%)
GstA 7..202 CDD:223698 47/213 (22%)
GST_C_family 93..218 CDD:295467 31/158 (20%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 14/49 (29%)
GST_C_Ure2p 208..350 CDD:198326 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.