DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and TEF4

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:52/244 - (21%)
Similarity:92/244 - (37%) Gaps:62/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKFSNSPVEYCPIALRKFEQL---------TDEYKKINRFQKVPAIVG-GDFHLSETIAIIRYLA 77
            |..:.||..|...||..:.:|         :.|:..:...::.||.:| ....|:|.:||..|||
Yeast     6 LYINRSPRNYASEALISYFKLDVKIVDLEQSSEFASLFPLKQAPAFLGPKGLKLTEALAIQFYLA 70

  Fly    78 DKGQFDEKLYPKTLENRARV--------DEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPE 134
            :: ..|||       .|||:        .:.|.|..|......|...|....|  .|:.|..| :
Yeast    71 NQ-VADEK-------ERARLLGSDVIEKSQILRWASLANSDVMSNIARPFLSF--KGLIPYNK-K 124

  Fly   135 QIQALIEGVENNLGLLERLWLENDFLVGKNLTMAD-------------ILGSSEINQLRLCQYRV 186
            .:.|....::|...:.:....:..|:..:|:::.|             |||.         ::|.
Yeast   125 DVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGP---------EWRA 180

  Fly   187 DEKKFPKVVKWLERVRVS---ANPY-----HDEGLTFIDRKSKQSTAAK 227
               |.|.:::|...|..|   ..|:     .::.||:...|.:::...|
Yeast   181 ---KHPHLMRWFNTVAASPIVKTPFAEVKLAEKALTYTPPKKQKAEKPK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 18/66 (27%)
GstA 7..202 CDD:223698 45/209 (22%)
GST_C_family 93..218 CDD:295467 29/153 (19%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 18/65 (28%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 24/136 (18%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345032
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.