DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and YGR201C

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:51/202 - (25%)
Similarity:88/202 - (43%) Gaps:35/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVG--GDFHLSETIAIIRYL- 76
            :.|||...||..        :.|.........|::....:|.|..||  .::.|:|.:||..|| 
Yeast    20 VPRGLVRSLKLD--------VKLADPSDAQQLYEREFPLRKYPTFVGPHDEWTLTEAMAIDYYLI 76

  Fly    77 ---ADKGQFDEKLYPK-TLENRARVDEFLEWQHLN----IRLACSMYFRDAWLFPMNGIAPKPKP 133
               :||....:.|.|: ..:.||   :.|.|:.|:    :...|.::      ||:.|:.|....
Yeast    77 HLSSDKEAVRQLLGPEGDFKTRA---DILRWESLSNSDFLNEVCEVF------FPLIGVKPYNAT 132

  Fly   134 EQIQALIEGVENNLGLLERLWLENDFLV-GKNLTMADILGSSEINQLRLCQYRVDE---KKFPKV 194
            | .:|..|.|:..:.|.|:...:..:|| ..:.|:||::.::..: |....: .||   .|.|:|
Yeast   133 E-FKAARENVDTIVSLYEKRLKKQQYLVCDDHETLADLISAAAFS-LGFISF-FDETWRSKHPEV 194

  Fly   195 VKWLERV 201
            .:|..||
Yeast   195 TRWFNRV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 18/70 (26%)
GstA 7..202 CDD:223698 51/202 (25%)
GST_C_family 93..218 CDD:295467 30/117 (26%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 17/65 (26%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 30/116 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345026
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.