Sequence 1: | NP_724816.3 | Gene: | GstT2 / 246386 | FlyBaseID: | FBgn0050005 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011717.4 | Gene: | YGR201C / 853115 | SGDID: | S000003433 | Length: | 225 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 202 | Identity: | 51/202 - (25%) |
---|---|---|---|
Similarity: | 88/202 - (43%) | Gaps: | 35/202 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 IARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVG--GDFHLSETIAIIRYL- 76
Fly 77 ---ADKGQFDEKLYPK-TLENRARVDEFLEWQHLN----IRLACSMYFRDAWLFPMNGIAPKPKP 133
Fly 134 EQIQALIEGVENNLGLLERLWLENDFLV-GKNLTMADILGSSEINQLRLCQYRVDE---KKFPKV 194
Fly 195 VKWLERV 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT2 | NP_724816.3 | GST_N_Theta | 5..80 | CDD:239348 | 18/70 (26%) |
GstA | 7..202 | CDD:223698 | 51/202 (25%) | ||
GST_C_family | 93..218 | CDD:295467 | 30/117 (26%) | ||
YGR201C | NP_011717.4 | Thioredoxin_like | 4..78 | CDD:412351 | 17/65 (26%) |
GST_C_EF1Bgamma_like | 98..220 | CDD:198290 | 30/116 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C157345026 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |