DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GTT2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:53/229 - (23%)
Similarity:80/229 - (34%) Gaps:46/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPIRFYYDLLSPIARGLWIGLKFSN--SPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGD 63
            |.:.:..|.....|....:.|.|...|  |.|::..|.|.|.|....|:...|....||.:...|
Yeast    15 MKQKMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDD 79

  Fly    64 FHL-SETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGI 127
            ..| :|..||..|: |.......|..||...:..:....:...|.:....|:||..|    ..|:
Yeast    80 GTLIAECTAITEYI-DALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHHA----TPGL 139

  Fly   128 APKPKPEQIQALIEGVEN-NLGLLER------------LWLENDFLVGKNLTMADIL-------- 171
            .|:         :|..:| ..||.:|            :..|..::.|.:.:||||.        
Yeast   140 GPE---------VELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIFA 195

  Fly   172 ------GSSEINQLRLCQYRVDEKKFPKVVKWLE 199
                  ...|...||....|:.::  |.|.|.||
Yeast   196 AIVKLQVPEECEALRAWYKRMQQR--PSVKKLLE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 22/77 (29%)
GstA 7..202 CDD:223698 52/223 (23%)
GST_C_family 93..218 CDD:295467 27/134 (20%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 21/75 (28%)
GST_C_GTT2_like 106..222 CDD:198291 24/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345125
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.