DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GSTF6

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:222 Identity:53/222 - (23%)
Similarity:88/222 - (39%) Gaps:58/222 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLA 77
            |...|.:.|.|...|...|:..:.|:..|...:.:...|.|.||||...|||.:.|:.||.:|:|
plant    12 STATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQYIA 76

  Fly    78 ----DKGQ------FDEKLYPKTLENRAR----VDEFLEWQHLNIRLACSMYFRDAWLFPMNGI- 127
                |||.      .|..:....:|..:.    |...|.|:.:              |.|:.|: 
plant    77 HEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQV--------------LKPLYGMT 127

  Fly   128 APKPKPEQIQA----LIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRV-- 186
            ..|...|:.:|    :::..|:.||       |:.:|...:.|:.|      ::.:.:.||.:  
plant   128 TDKTVVEEEEAKLAKVLDVYEHRLG-------ESKYLASDHFTLVD------LHTIPVIQYLLGT 179

  Fly   187 ------DEKKFPKVVKWLERV--RVSA 205
                  ||:  |.|..|:..:  |.||
plant   180 PTKKLFDER--PHVSAWVADITSRPSA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 23/70 (33%)
GstA 7..202 CDD:223698 50/217 (23%)
GST_C_family 93..218 CDD:295467 26/132 (20%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 21/64 (33%)
GST_C_Phi 91..208 CDD:198296 28/143 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.