DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GSTF5

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:196 Identity:50/196 - (25%)
Similarity:82/196 - (41%) Gaps:36/196 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VEYCPIALRKF--EQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLA----DKGQ--FDEKL 86
            :.|.||.:...  :|....:..||.|.:||..:.|...|:|:.||..|:|    .:|.  .:.|.
plant    87 LSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRAISEYIATVHKSRGTQLLNYKS 151

  Fly    87 YPKTLENR---ARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPK-PEQIQALIEGVENNL 147
            | ||:..:   ..::.| |:..|...|......:     ||.|:....| ..:.:|.:|.|   |
plant   152 Y-KTMGTQRMWMAIESF-EFDPLTSTLTWEQSIK-----PMYGLKTDYKVVNETEAKLEKV---L 206

  Fly   148 GLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVD---EKKF---PKVVKWLERVRVSAN 206
            .:.|.....:.||...:.||||:.....|      ||.:|   ::.|   |.|.:|:  ..::|.
plant   207 DIYEERLKNSSFLASNSFTMADLYHLPNI------QYLMDTHTKRMFVNRPSVRRWV--AEITAR 263

  Fly   207 P 207
            |
plant   264 P 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 16/55 (29%)
GstA 7..202 CDD:223698 48/189 (25%)
GST_C_family 93..218 CDD:295467 29/125 (23%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 15/48 (31%)
GST_C_Phi 153..270 CDD:198296 31/129 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.