Sequence 1: | NP_724816.3 | Gene: | GstT2 / 246386 | FlyBaseID: | FBgn0050005 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_171791.1 | Gene: | GSTF7 / 839295 | AraportID: | AT1G02920 | Length: | 209 | Species: | Arabidopsis thaliana |
Alignment Length: | 223 | Identity: | 56/223 - (25%) |
---|---|---|---|
Similarity: | 86/223 - (38%) | Gaps: | 59/223 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 SPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLA 77
Fly 78 ----DKGQFDEKLYPKTLENRAR-----------VDEFLEWQHLNIRLACSMYFRDAWLFPMNGI 127
Fly 128 -APKPKPEQIQA----LIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRV- 186
Fly 187 -------DEKKFPKVVKWLERV--RVSA 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT2 | NP_724816.3 | GST_N_Theta | 5..80 | CDD:239348 | 25/70 (36%) |
GstA | 7..202 | CDD:223698 | 53/218 (24%) | ||
GST_C_family | 93..218 | CDD:295467 | 27/139 (19%) | ||
GSTF7 | NP_171791.1 | GST_N_Phi | 4..77 | CDD:239351 | 23/64 (36%) |
GST_C_Phi | 95..209 | CDD:198296 | 27/140 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100130 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.720 |