DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Clic4

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:240 Identity:56/240 - (23%)
Similarity:80/240 - (33%) Gaps:105/240 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LWI-GLKFSNSPVE---------------YCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLS 67
            ||: |:.||.:.|:               :.|......|..|| ..||..|            |.
  Rat    45 LWLKGVVFSVTTVDLKRKPAHLQNLAPGTHPPFITFNSEVKTD-VNKIEEF------------LE 96

  Fly    68 ETIAIIRYLADKGQFDEKLYPKTLE-NRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKP 131
            |.:...:||        ||.||..| |.|.:|.|.::         |.|.:::            
  Rat    97 EVLCPPKYL--------KLSPKHPESNTAGMDIFAKF---------SAYIKNS------------ 132

  Fly   132 KPEQIQALIEGVENNLGLLERLWL---------END----------FLVGKNLTMADILGSSEIN 177
            :||..:||..|:...|..|:. :|         ||.          ||.|..:|:||        
  Rat   133 RPEANEALERGLLKTLQKLDE-YLNSPLPGEIDENSMEDIKSSTRRFLDGDEMTLAD-------- 188

  Fly   178 QLRLCQYRVDEKKFPKVVKWLERVRVSANPYHD----EGLTFIDR 218
                |..      .||    |..|:|.|..|.:    :|:|.|.|
  Rat   189 ----CNL------LPK----LHIVKVVAKKYRNFDIPKGMTGIWR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 17/76 (22%)
GstA 7..202 CDD:223698 48/218 (22%)
GST_C_family 93..218 CDD:295467 33/147 (22%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 15/68 (22%)
GST_N_CLIC 14..104 CDD:239359 15/71 (21%)
O-ClC 17..252 CDD:129941 56/240 (23%)
GST_C_family 111..251 CDD:295467 35/153 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.