DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GSTT2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:244 Identity:79/244 - (32%)
Similarity:121/244 - (49%) Gaps:30/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSET 69
            ::.|.|.:|..:|.:.|..|.:....:...|:|.|.:||:.|:|:||...||||||.|...|.|:
plant     3 LKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFES 67

  Fly    70 IAIIRYLADK-GQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKP 133
            .||:.||:.. ....:..||..|..||::...|:|.|.|:|...|.|..::.|.|..|:...|| 
plant    68 HAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNPK- 131

  Fly   134 EQIQALIEG---VENNLGLLERLWLEND--FLV-GKNLTMADILGSSEINQLRLCQYRVDEK--- 189
                |..|.   :.|:|..||..||:..  ||: ||..::||:....|:.||::    :|:|   
plant   132 ----AAAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQV----LDDKDRL 188

  Fly   190 ----KFPKVVKWLERVRVSANPYHDEGLTFI----DRKSKQ---STAAK 227
                ...||.:|:|..|.:..|:.||....:    ||..||   :||:|
plant   189 RLLSPHKKVEQWIESTRKATMPHSDEVHEVLFRAKDRFQKQREMATASK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 28/75 (37%)
GstA 7..202 CDD:223698 68/208 (33%)
GST_C_family 93..218 CDD:295467 41/141 (29%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 28/74 (38%)
GST_C_Theta 92..221 CDD:198292 41/137 (30%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3657
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm1047
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.680

Return to query results.
Submit another query.