DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GSTF12

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:177 Identity:55/177 - (31%)
Similarity:84/177 - (47%) Gaps:35/177 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRY----LADKGQF 82
            |::|     |...|.|..|||...|:.....|.:||||..|||.|.|:.||.||    .||:|  
plant    25 GIEF-----EIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKFADQG-- 82

  Fly    83 DEKLYPKTLENRARVDEF--LEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIEGVEN 145
             ..|..|:||:||.||::  :|..:.|: ||..:.....       |.|:...:....|:|.::.
plant    83 -TNLLGKSLEHRAIVDQWADVETYYFNV-LAQPLVINLI-------IKPRLGEKCDVVLVEDLKV 138

  Fly   146 NLGLLERLW----LENDFLVGKNLTMAD---------ILGSSEINQL 179
            .||::..::    ..|.||.|:..||||         ::..::|||:
plant   139 KLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQM 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 25/61 (41%)
GstA 7..202 CDD:223698 55/177 (31%)
GST_C_family 93..218 CDD:295467 25/102 (25%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 55/177 (31%)
GST_N_Phi 2..77 CDD:239351 23/56 (41%)
GST_C_Phi 91..209 CDD:198296 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.