DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GSTF10

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:190 Identity:51/190 - (26%)
Similarity:90/190 - (47%) Gaps:26/190 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFD-EK 85
            |:.|....|:     |.|.||...||..|..|.|:|.:|.||:.:.|:.||:||:|:|.:.. ..
plant    24 GVSFETVNVD-----LMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYRSQGPD 83

  Fly    86 LYPKTLENRARVDEFLEWQHLN-----IRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIEGVEN 145
            |..||:|.|.:|:::|:.:..:     :.|..::.|.....||.:....|...|::..:::..|.
plant    84 LLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIKESEEKLAEVLDVYEA 148

  Fly   146 NLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVKWLERVRVSA 205
            .|.       :|::|.|..:::||:.      .|...:|.|.......::|  :|..|||
plant   149 QLS-------KNEYLAGDFVSLADLA------HLPFTEYLVGPIGKAHLIK--DRKHVSA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 22/57 (39%)
GstA 7..202 CDD:223698 48/185 (26%)
GST_C_family 93..218 CDD:295467 24/118 (20%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 51/190 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.