DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GSTF3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:210 Identity:48/210 - (22%)
Similarity:84/210 - (40%) Gaps:40/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLA 77
            |...|.:.|.|...|...|...:.|:..|...:.:...|.|.:|||...||..|.|:.||.:|:|
plant    12 STSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIA 76

  Fly    78 DKGQFD-EKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQI----- 136
            .:.:.. ..|.|...:|.|      ::..::|.:....:..|.       :|.|...||:     
plant    77 HRYENQGTNLLPADSKNIA------QYAIMSIGIQVEAHQFDP-------VASKLAWEQVFKFNY 128

  Fly   137 -----QALIEGVENNLG----LLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRV---DEK 189
                 ||::...|..|.    :.|....|..:|.|:..|:.|      ::.:.:.||.:   .:|
plant   129 GLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTD------LHHIPVIQYLLGTPTKK 187

  Fly   190 KF---PKVVKWLERV 201
            .|   |:|.:|:..:
plant   188 LFTERPRVNEWVAEI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 21/66 (32%)
GstA 7..202 CDD:223698 48/210 (23%)
GST_C_family 93..218 CDD:295467 25/129 (19%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 48/210 (23%)
GST_N_Phi 4..78 CDD:239351 21/65 (32%)
GST_C_Phi 96..212 CDD:198296 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.