DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:254 Identity:47/254 - (18%)
Similarity:87/254 - (34%) Gaps:91/254 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRY---------------------LAD 78
            ::|.:.|.....:.::|..::||.|:..|..:|:...||.|                     ||.
Human    77 VSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGGGRGRCPSGFPAQPLAV 141

  Fly    79 KGQFDEKLYPK--TLENRARVDEFLEWQHLNIRLACSMYFRDAWLFP---MNGIAPKPKPEQIQA 138
            ..:....|.|:  :|:: |||   |:::.|...|....|.....|.|   .:.:.||....:|:.
Human   142 PTEHVVALMPEVGSLQH-ARV---LQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRR 202

  Fly   139 LIEGVENNL--------------------------------------------------GLLERL 153
            .:.....:|                                                  ..||:.
Human   203 HLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKR 267

  Fly   154 WLEND------FLVGKNLTMADILGSSEINQLRLC----QYRVDEKKFPKVVKWLERVR 202
            .|||:      :|.|...|:||:|..:.:::|:..    :|..|..: |.:..:.|||:
Human   268 KLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSR-PNLQSFFERVQ 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 13/65 (20%)
GstA 7..202 CDD:223698 46/252 (18%)
GST_C_family 93..218 CDD:295467 31/173 (18%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 47/254 (19%)
GST_N_GDAP1 47..119 CDD:239350 11/41 (27%)
GST_C_GDAP1L1 220..330 CDD:198335 18/107 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.