DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Clic3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_030107910.1 Gene:Clic3 / 69454 MGIID:1916704 Length:268 Species:Mus musculus


Alignment Length:169 Identity:35/169 - (20%)
Similarity:58/169 - (34%) Gaps:43/169 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLS-----ETIAIIRYLADKGQFDEKLYPK 89
            |.:||...|.|              .|..:.|..|.|:     ..:.:::..|...|....||..
Mouse    51 VGHCPSCQRLF--------------MVLLLKGVPFTLTTVDTRRALDVLKDFAPGSQLPILLYDG 101

  Fly    90 TLE-NRARVDEFLE-------WQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIEGVENN 146
            .:: :..:::||||       :..|..|...|....:......:.....|.|.|..||.:.:...
Mouse   102 DVKTDTLQIEEFLEETLGPPDFPSLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDNALYQQLLRA 166

  Fly   147 LGLLE---RLWLEND-------------FLVGKNLTMAD 169
            |..|:   |..|:::             ||.|...|:||
Mouse   167 LTRLDSYLRAPLDHELAQEPHLRESHRRFLDGDQFTLAD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 10/54 (19%)
GstA 7..202 CDD:223698 35/169 (21%)
GST_C_family 93..218 CDD:295467 22/100 (22%)
Clic3XP_030107910.1 O-ClC 43..261 CDD:129941 35/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.