DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Gstz1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001102915.1 Gene:Gstz1 / 681913 RGDID:1589363 Length:216 Species:Rattus norvegicus


Alignment Length:235 Identity:48/235 - (20%)
Similarity:90/235 - (38%) Gaps:70/235 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRK--FEQLTDEYKKINRFQKVPAIVGGDFH 65
            ||:.:.| ..|..:..:.|.|.......|..||.|.|  .:|.::|::.:|..::|||:......
  Rat     5 KPVLYSY-FRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGIT 68

  Fly    66 LSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPK 130
            :.:::||:.||.:.... .:|.|:..:.||.|           |:...:.        .:||.|.
  Rat    69 IGQSLAILEYLEETRPI-PRLLPQDPQKRAIV-----------RMISDLI--------ASGIQPL 113

  Fly   131 PKPEQIQALIEGVENNLGLLERLWLEND-------------------------FLVGKNLTMADI 170
                          .||.:|:::..||.                         :.||..::|||:
  Rat   114 --------------QNLSVLKQVGQENQMPWAQKAITSGFNALEKILQSTAGKYCVGDEVSMADV 164

  Fly   171 LGSSEINQLRLCQYRVDEKKFP------KVVKWLERVRVS 204
            ..:.::....  :::||...:|      |.:..||..:||
  Rat   165 CLAPQVANAE--RFKVDLSPYPTISHINKALLALEAFQVS 202

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 19/76 (25%)
GstA 7..202 CDD:223698 44/227 (19%)
GST_C_family 93..218 CDD:295467 25/143 (17%)
Gstz1NP_001102915.1 GST_N_Zeta 6..80 CDD:239340 19/74 (26%)
maiA 7..211 CDD:273527 46/233 (20%)
Glutathione binding. /evidence=ECO:0000250 14..19 1/4 (25%)