DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstD10

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:188 Identity:49/188 - (26%)
Similarity:85/188 - (45%) Gaps:27/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEK 85
            :|::|....:    |..|..||.|.||.|||....:|.:....|.|.|:.||:.||.:|...|:|
  Fly    22 LGVEFDKKTI----INTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMVYLVEKYGKDDK 82

  Fly    86 LYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIEGVENNLGLL 150
            |:||.::.:|.:::.|.:....:..:.|.|:     :|.. ...||..|:....||.....|   
  Fly    83 LFPKDVQKQALINQRLYFDMGTLYKSFSEYY-----YPQI-FLKKPANEENYKKIEVAFEFL--- 138

  Fly   151 ERLWLENDFLVGK------NLTMADILGSSEINQLRLCQYRVDEKKFPKVVKWLERVR 202
                  |.||.|:      :.::|||...:.::...:..:  |.|::..|.:|.|..:
  Fly   139 ------NTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGF--DFKRYANVARWYENAK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 20/58 (34%)
GstA 7..202 CDD:223698 49/186 (26%)
GST_C_family 93..218 CDD:295467 23/116 (20%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 20/56 (36%)
PLN02473 3..196 CDD:166114 49/188 (26%)
GST_C_Delta_Epsilon 89..205 CDD:198287 23/117 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460055
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.