DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and gdap1l1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:154 Identity:38/154 - (24%)
Similarity:63/154 - (40%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADK--GQFDEKLYP-KTLENRAR 96
            ::|...||....:.::|..::||..:.||..:|:...||.|:...  |....:|.| :.....||
Zfish    78 VSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSDYNQIIDYIETNFVGDTVAQLIPDEGTPMYAR 142

  Fly    97 VDEFLEWQHLNIRLACSMYFRDAWLFP---MNGIAPKPKPEQIQALIEGVENNLGLL--ERLWLE 156
            |.::.|   |...|....|.....|.|   .:.:.||....:|:..:....:.|..|  |...|.
Zfish   143 VQQYRE---LLDGLPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANAASELMKLDHEEPQLT 204

  Fly   157 NDFLVGKNLTMADILGSSEINQLR 180
            ..:|..:...||.||....:|.|:
Zfish   205 EPYLSKQKKLMAKILDHDNVNYLK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 12/46 (26%)
GstA 7..202 CDD:223698 38/154 (25%)
GST_C_family 93..218 CDD:295467 23/93 (25%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 38/154 (25%)
Thioredoxin_like 48..120 CDD:294274 12/41 (29%)
GST_C_GDAP1L1 201..311 CDD:198335 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.