DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and gdap1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:186 Identity:39/186 - (20%)
Similarity:74/186 - (39%) Gaps:32/186 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRA-----RVDEFLEWQHL 106
            :.::|...:||.:|..:..:.:...|:.||  :..|.::..||.:....     ||..:.|   |
Zfish    82 FMRLNPTGEVPVLVHDNHVICDPTQIMDYL--EQNFCDEQTPKLIPEEGSTYYHRVQHYRE---L 141

  Fly   107 NIRLACSMYFRDAWLFP---MNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMA 168
            ...|....|.....|.|   ::...|......|:..|...|:.   |::|.:||..|  |:..:|
Zfish   142 LDSLQMDAYTHGCILHPEITVDSHIPAYATTHIRTQIGNTESE---LKKLAVENPDL--KDAYIA 201

  Fly   169 DILGSSEINQLRLCQYRVDEKKFP-KVVKWLERVRVSANPYHDEGLTFIDRKSKQS 223
            .             |.|:..|.|. ..:|:|:::........|:..|.:.|:|:::
Zfish   202 K-------------QRRLKSKLFDHDNMKYLKKLLDELENVLDQVETELQRRSEET 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 7/32 (22%)
GstA 7..202 CDD:223698 35/163 (21%)
GST_C_family 93..218 CDD:295467 27/133 (20%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 39/186 (21%)
GST_N_GDAP1 40..112 CDD:239350 7/31 (23%)
GST_C_family 193..304 CDD:295467 13/67 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.