DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and CLIC6

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_016883895.1 Gene:CLIC6 / 54102 HGNCID:2065 Length:735 Species:Homo sapiens


Alignment Length:174 Identity:35/174 - (20%)
Similarity:52/174 - (29%) Gaps:65/174 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LRKFEQLTDE------YKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRA 95
            :.|.|:..:|      |.|:..........|.|.....:..|.....|..:..||...|.|.   
Human   522 VNKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIHEKNLLKALR--- 583

  Fly    96 RVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQA------LIEGVENNLGLLERLW 154
            ::|.:|.                           .|.|::|.|      .:.|            
Human   584 KLDNYLN---------------------------SPLPDEIDAYSTEDVTVSG------------ 609

  Fly   155 LENDFLVGKNLTMAD--ILGSSEINQLRL-----CQYRVDEKKF 191
              ..||.|..||:||  :|....|.::.|     |  ||.|:.|
Human   610 --RKFLDGDELTLADCNLLPKLHIIKVHLPSRHVC--RVHERGF 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 9/48 (19%)
GstA 7..202 CDD:223698 35/174 (20%)
GST_C_family 93..218 CDD:295467 22/112 (20%)
CLIC6XP_016883895.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.