DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and CLIC5

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001107558.1 Gene:CLIC5 / 53405 HGNCID:13517 Length:410 Species:Homo sapiens


Alignment Length:157 Identity:36/157 - (22%)
Similarity:53/157 - (33%) Gaps:54/157 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLE-NRARVDEFLEWQHLNIR 109
            :..||..|            |.||:...:|        .||..|..| |.|.:|.|.::      
Human   243 DVNKIEEF------------LEETLTPEKY--------PKLAAKHRESNTAGIDIFSKF------ 281

  Fly   110 LACSMYFRDA--------------WLFPMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFL 160
               |.|.::.              .|..::.....|.||:|.|      |..|  |.......||
Human   282 ---SAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDA------NTCG--EDKGSRRKFL 335

  Fly   161 VGKNLTMAD--ILGSSEINQLRLCQYR 185
            .|..||:||  :|....:.::...:||
Human   336 DGDELTLADCNLLPKLHVVKIVAKKYR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 7/33 (21%)
GstA 7..202 CDD:223698 36/157 (23%)
GST_C_family 93..218 CDD:295467 25/109 (23%)
CLIC5NP_001107558.1 O-ClC 173..408 CDD:129941 36/157 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.