DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Gstt3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:201 Identity:67/201 - (33%)
Similarity:115/201 - (57%) Gaps:3/201 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSET 69
            :..|.||:|...|.::|..|.:..|.:...|.|.|.:..||.:.::|..:||||:..|||.|:|:
  Rat    60 LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVLAES 124

  Fly    70 IAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPE 134
            :||:.||:.|.:..:..||:.|:.||||||:|.|||..:|..||.......:||:....|.| ||
  Rat   125 VAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVFLGQPVP-PE 188

  Fly   135 QIQALIEGVENNLGLLERLWLEND-FLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVKWL 198
            ::.:.:..::..|.:||..:|:|. ||.|.::::||::..:|:........::.|.: ||:..|.
  Rat   189 RLASTLAELDGCLQMLEDKFLQNKAFLTGPHISVADLVAITELMHPVSAGCKIFESR-PKLAAWR 252

  Fly   199 ERVRVS 204
            :||..:
  Rat   253 QRVEAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 27/74 (36%)
GstA 7..202 CDD:223698 66/195 (34%)
GST_C_family 93..218 CDD:295467 36/113 (32%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 27/74 (36%)
GST_C_Theta 149..273 CDD:198292 36/112 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348069
Domainoid 1 1.000 47 1.000 Domainoid score I11660
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.650

Return to query results.
Submit another query.