DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:203 Identity:70/203 - (34%)
Similarity:107/203 - (52%) Gaps:6/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKF-EQLTDEYKKINRFQKVPAIVGGDFH 65
            |..:..|.||||...|.::|..|.:..|..||.:.|.|. |.||.|:.|::...||||:..|:|.
 Frog     3 SSELTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGNFT 67

  Fly    66 LSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPK 130
            ::|:.|::.|||.|.:.....||..|:.||||||:|.|||.|.|...|..|....:.|.  |..|
 Frog    68 MAESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPT--ILGK 130

  Fly   131 PKP-EQIQALIEGVENNLGLLERLWLEN-DFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPK 193
            ..| |::.|::......:...|..:|.| .|:.|..:::||::...||.|:......|.|:: ||
 Frog   131 EVPSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFEER-PK 194

  Fly   194 VVKWLERV 201
            :..|.:|:
 Frog   195 LGSWKQRL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 29/75 (39%)
GstA 7..202 CDD:223698 69/198 (35%)
GST_C_family 93..218 CDD:295467 36/111 (32%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 29/75 (39%)
GST_C_Theta 95..221 CDD:198292 36/111 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9934
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54888
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.