DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and gsto2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001007373.1 Gene:gsto2 / 492500 ZFINID:ZDB-GENE-041114-67 Length:240 Species:Danio rerio


Alignment Length:194 Identity:45/194 - (23%)
Similarity:70/194 - (36%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VEYCPIALRKFEQLT-----------------DEYKKINRFQKVPAI-VGGDFHLSETIAIIRYL 76
            :.:||.|.|....||                 |.:.|.|.|..||.: ......:.|:.....||
Zfish    28 MRFCPFAQRTRLVLTAKGVKHDIININLVSKPDWFLKKNPFGTVPVLETSSGQVIYESPITCEYL 92

  Fly    77 ADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIE 141
             |:...::||.|.....||:....||           :|.:....|....:..|...:...|..|
Zfish    93 -DEVYPEKKLLPSDPFERAQQKMLLE-----------LYSKVIPYFYKISMGKKRGEDVSTAEAE 145

  Fly   142 GVENNLGLLERLW-LENDFLVGKNLTMADIL-----GSSEINQLRLCQYRVDEKKFPKVVKWLE 199
            ..|..|.|.|.|. .:..:..|.::||.|.|     ..:|:..::.|.     .|.|::.||:|
Zfish   146 FTEKLLQLNEALANKKTKYFGGDSITMIDYLIWPWFERAEMMGVKHCL-----AKTPELRKWIE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 16/67 (24%)
GstA 7..202 CDD:223698 45/194 (23%)
GST_C_family 93..218 CDD:295467 26/113 (23%)
gsto2NP_001007373.1 GST_N_Omega 4..93 CDD:239353 15/65 (23%)
GstA 25..210 CDD:223698 45/194 (23%)
GST_C_Omega 107..229 CDD:198293 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.