DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstD5

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:203 Identity:51/203 - (25%)
Similarity:97/203 - (47%) Gaps:35/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FYYD---------LLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGG 62
            |||.         ::...|.|:.:.:|..|:        |.| :||..|:.|:|....:|.:|..
  Fly     3 FYYSPRGSGCRTVIMVAKALGVKLNMKLLNT--------LEK-DQLKPEFVKLNPQHTIPTLVDN 58

  Fly    63 DFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPM--N 125
            .|.:.|:.||..||.:|...|:.|:||..:.:|.|::.|.:....:..:.:.|:     :|:  .
  Fly    59 GFSIWESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYY-----YPLFHT 118

  Fly   126 GIAPKPKPEQIQALIEGVENNLGLLERLWLE-NDFLVGKNLTMADILGSSEINQLRLCQYRVDEK 189
            |   ||..::.   .:.:|::...| .::|| .:::.|.:||:|||...|.::...:..:  |..
  Fly   119 G---KPGSDED---FKKIESSFEYL-NIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDF--DLN 174

  Fly   190 KFPKVVKW 197
            |:|.|.:|
  Fly   175 KYPNVARW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 22/81 (27%)
GstA 7..202 CDD:223698 51/203 (25%)
GST_C_family 93..218 CDD:295467 24/108 (22%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 51/203 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/79 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/109 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460051
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.