DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstD4

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:207 Identity:49/207 - (23%)
Similarity:94/207 - (45%) Gaps:16/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIA 71
            |||...|..:|.:.:..|.....:....:.:.:.|.|..|:.|:|....:|.:|...|.:.|:.|
  Fly     3 FYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRA 67

  Fly    72 IIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNG-IAPKPKPEQ 135
            |..||.:|...|:.|:|...:.||.:::.|.:....:..:...|:   :.|...| :......::
  Fly    68 IAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYY---YPFIRTGQLGNAENYKK 129

  Fly   136 IQALIEGVENNLGLLERLWLE-NDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVKWLE 199
            ::|..|.::        ::|| .|::.|..||:|||...|.::...:.::  |..|:|.|.:|..
  Fly   130 VEAAFEFLD--------IFLEGQDYVAGSQLTVADIAILSSVSTFEVVEF--DISKYPNVARWYA 184

  Fly   200 RVRVSANPYHDE 211
            ..: ...|..||
  Fly   185 NAK-KITPGWDE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 19/72 (26%)
GstA 7..202 CDD:223698 46/196 (23%)
GST_C_family 93..218 CDD:295467 26/121 (21%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 46/193 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/70 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460057
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.