DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstD3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:218 Identity:50/218 - (22%)
Similarity:94/218 - (43%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQF 82
            |..:||:|:...:.     ..|.||:..::.|||....:|.:|...|.:.|:.||:.||.:|...
  Fly     3 GKALGLEFNKKIIN-----TLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGK 62

  Fly    83 DEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQ-----IQALIEG 142
            |:.||||.::.:|.:::.|.:....:....:.|:..|:.....|.....|..|     :...:||
  Fly    63 DDALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEG 127

  Fly   143 VENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVKWLERVRVSANP 207
                          .|::.|...|:|||...:.::...:..:  |..|:|.|.:|.:.|:.....
  Fly   128 --------------QDYVAGDQYTVADIAILANVSNFDVVGF--DISKYPNVARWYDHVKKITPG 176

  Fly   208 YHDEGLTFIDRKSK---QSTAAK 227
            :.:.....:|.|.:   :..|||
  Fly   177 WEENWAGALDVKKRIEEKQNAAK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 18/61 (30%)
GstA 7..202 CDD:223698 44/188 (23%)
GST_C_family 93..218 CDD:295467 21/129 (16%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 18/59 (31%)
GstA 6..173 CDD:223698 44/187 (24%)
GST_C_Delta_Epsilon 72..188 CDD:198287 22/131 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460060
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.