DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstD2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:216 Identity:51/216 - (23%)
Similarity:94/216 - (43%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FYY---------DLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGG 62
            |||         .::...|.||.:..|..|:         .:.|||..|:.|:|....:|.:|..
  Fly     3 FYYMPGGGGCRTVIMVAKALGLELNKKLLNT---------MEGEQLKPEFVKLNPQHTIPTLVDN 58

  Fly    63 DFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPM--N 125
            .|.:.|:.||..||.:|...|:.|.|...:.||.:::.|.:....:..:.:.|:     :|:  .
  Fly    59 GFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYY-----YPLFRT 118

  Fly   126 GIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKK 190
            |   ||..::.   ::.:|...|.|:......:::.|..||:|||...|.::...:.::  |..|
  Fly   119 G---KPGSDED---LKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEF--DFSK 175

  Fly   191 FPKVVKWLERVRVSANPYHDE 211
            :..|.:|.:..: ...|..||
  Fly   176 YSNVSRWYDNAK-KVTPGWDE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 22/81 (27%)
GstA 7..202 CDD:223698 48/205 (23%)
GST_C_family 93..218 CDD:295467 25/121 (21%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/79 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.