DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:213 Identity:53/213 - (24%)
Similarity:97/213 - (45%) Gaps:44/213 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KFEQLTDEYKKINRFQ--KVPAIVGGD-FHLSETIAIIRYLADKGQFDEKLY-PKTLENRARVDE 99
            ||.:.....:.:.:|.  ||||....: .:|||:.||...||     :|:|. .|....:|:|.:
  Fly    36 KFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLA-----NEQLRGGKCPFVQAQVQQ 95

  Fly   100 FLEWQHLNI-RLACSMYFRDAWLFPMNGIAPKPK----PEQIQALIEGVENNLGLLERLWLENDF 159
            ::.:....| ..:|      ||:||:.||.|:.|    .::.:|:::.:...|       .:..|
  Fly    96 WISFADNEIVPASC------AWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKL-------QDATF 147

  Fly   160 LVGKNLTMADILGSSEINQLRLCQYRVD---EKKFPKVVKWL------ERVRVSANPYH--DEGL 213
            |.|:.:|:|||:..|.:  |.|.:|.::   ...|..|.:|.      ::|:.....|.  ::.|
  Fly   148 LAGERITLADIVVFSSL--LHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKDYKLCEKAL 210

  Fly   214 TFIDRK----SKQSTAAK 227
            .|..:|    ..::.|||
  Fly   211 VFDPKKYAEFQAKTGAAK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 14/43 (33%)
GstA 7..202 CDD:223698 45/180 (25%)
GST_C_family 93..218 CDD:295467 32/140 (23%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 14/47 (30%)
GstA 5..187 CDD:223698 44/170 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 30/133 (23%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459930
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.