Sequence 1: | NP_724816.3 | Gene: | GstT2 / 246386 | FlyBaseID: | FBgn0050005 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002621.1 | Gene: | gsto1 / 436894 | ZFINID: | ZDB-GENE-040718-365 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 227 | Identity: | 47/227 - (20%) |
---|---|---|---|
Similarity: | 83/227 - (36%) | Gaps: | 57/227 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 VEYCPIALR----------KFEQLT-------DEYKKINRFQKVPAI--VGGDFHLSETIAIIRY 75
Fly 76 LADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALI 140
Fly 141 EGVENNLGLLERLWL--ENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVKWLERVR- 202
Fly 203 ---------------------VSANPYHDEGL 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT2 | NP_724816.3 | GST_N_Theta | 5..80 | CDD:239348 | 14/68 (21%) |
GstA | 7..202 | CDD:223698 | 42/192 (22%) | ||
GST_C_family | 93..218 | CDD:295467 | 30/145 (21%) | ||
gsto1 | NP_001002621.1 | GST_N_Omega | 4..93 | CDD:239353 | 13/66 (20%) |
GstA | 25..210 | CDD:223698 | 42/195 (22%) | ||
GST_C_Omega | 107..229 | CDD:198293 | 25/133 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589453 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |