DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and clic2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001002561.2 Gene:clic2 / 436834 ZFINID:ZDB-GENE-040718-299 Length:239 Species:Danio rerio


Alignment Length:219 Identity:44/219 - (20%)
Similarity:75/219 - (34%) Gaps:93/219 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LWI-GLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQF 82
            ||: |:||:.:.|:     :||   ..||.|.:......|.:                       
Zfish    39 LWLKGVKFTVTTVD-----MRK---KPDELKDLAPGTNPPFL----------------------- 72

  Fly    83 DEKLYPKTLE-NRARVDEFLE-------WQHLNIR------------LACSMYFRDAWLFPMNGI 127
               ||..||: :..:::||||       :.||:.|            ...|.:.:::   |.|..
Zfish    73 ---LYNGTLKTDFIKIEEFLETTLAPPRYPHLSPRYKESFDVGADIFAKFSAFIKNS---PNNAF 131

  Fly   128 APKPKPEQIQ--------ALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQY 184
            ..|....:.:        .|.:.::.|:.:.:|     .||.|..||:||            |..
Zfish   132 HEKALLREFKRLDDYLNTPLQDELDQNISVSKR-----KFLDGNRLTLAD------------CNL 179

  Fly   185 RVDEKKFPKVVKWLERVRVSANPY 208
                  .||    |..::|:|..|
Zfish   180 ------LPK----LHVIKVAARKY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 12/61 (20%)
GstA 7..202 CDD:223698 41/211 (19%)
GST_C_family 93..218 CDD:295467 28/143 (20%)
clic2NP_001002561.2 O-ClC 11..238 CDD:129941 44/219 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.