DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstD11

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:215 Identity:56/215 - (26%)
Similarity:99/215 - (46%) Gaps:16/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFH 65
            ||.|: .||...||..|.:.:..|..:...|...:.:.:.|||..::..:|....||.:......
  Fly    22 MSPPV-LYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLV 85

  Fly    66 LSETIAIIRYL-ADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGI-A 128
            |.|:.||:.|| |..|:.|: |||..:..||.||:.|::....:.:..:.|:     ||...| |
  Fly    86 LWESRAILSYLVAAYGKSDQ-LYPTDIRVRALVDQRLQFDLGTLYMRLTDYY-----FPTMFIGA 144

  Fly   129 PKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPK 193
            |..:.::.: |.|.|    |.|..:.....|....:.|:||:.....::||...::.:  :.:..
  Fly   145 PLDEGKRAK-LAEAV----GWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFEL--RPYKH 202

  Fly   194 VVKWLERVRVSANPYHDEGL 213
            :.:||:|.:....|:..|.|
  Fly   203 IRQWLDRCKDHMAPFDYEEL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 20/75 (27%)
GstA 7..202 CDD:223698 50/196 (26%)
GST_C_family 93..218 CDD:295467 28/122 (23%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 20/73 (27%)
GST_C_Delta_Epsilon 112..231 CDD:198287 28/123 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
54.820

Return to query results.
Submit another query.