DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstD9

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:201 Identity:51/201 - (25%)
Similarity:91/201 - (45%) Gaps:19/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FYYDLLSPIARGLW-----IGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHL 66
            |||.|.|...|.:.     :||:.:...|:     |...|.|..|:.|||....:|.:|...|.:
  Fly     4 FYYMLYSAPCRSILMTARALGLELNKKQVD-----LDAGEHLKPEFVKINPQHTIPTLVDDGFAI 63

  Fly    67 SETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKP 131
            .|:.||:.|||:|...|..||||..:.||.:::.|.:. |:......:|:....||  ..:....
  Fly    64 WESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFD-LSTLYQSYVYYYYPQLF--EDVKKPA 125

  Fly   132 KPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVK 196
            .|:.::.    :::...:...|.....:.....||:||....:.::...:.:|  |..|:|:||:
  Fly   126 DPDNLKK----IDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEY--DFGKYPEVVR 184

  Fly   197 WLERVR 202
            |.:..:
  Fly   185 WYDNAK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 25/77 (32%)
GstA 7..202 CDD:223698 51/199 (26%)
GST_C_family 93..218 CDD:295467 20/110 (18%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 24/75 (32%)
GstA 4..187 CDD:223698 51/196 (26%)
GST_C_Delta_Epsilon 89..207 CDD:198287 20/111 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460056
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.