DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and gfzf

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster


Alignment Length:183 Identity:54/183 - (29%)
Similarity:87/183 - (47%) Gaps:32/183 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLENR 94
            |::|.:     |..::||.|:|..:::|.:....|:|||:|||::||.||...|..|||:.:..|
  Fly   842 VDFCAM-----EHRSEEYSKMNPQKEIPVLDDDGFYLSESIAIMQYLCDKYAPDSTLYPQDVNVR 901

  Fly    95 ARVDEFLEWQHLNIRLACSMYFRDAWLFPM--NGIAP-----KPKPEQIQALIEGVENNLGLLER 152
            |.:         |.||..:|.|   :..|:  :.:||     |..|..::.    |:|.|.:.|.
  Fly   902 AVI---------NQRLCFNMGF---YYAPISAHSMAPIFFDYKRTPMSLKK----VQNALDVFET 950

  Fly   153 LW--LENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVKWLERVRV 203
            ..  |...:..|:|:|:||....|....|....:  |..:|..|.||.|..:|
  Fly   951 YLQRLGTKYAAGENITIADFALISATICLEAINF--DLHQFTLVNKWYETFKV 1001

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 18/49 (37%)
GstA 7..202 CDD:223698 53/180 (29%)
GST_C_family 93..218 CDD:295467 31/120 (26%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 17/48 (35%)
GstA 812..1000 CDD:223698 53/180 (29%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 31/120 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
54.820

Return to query results.
Submit another query.