DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and clic5b

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:157 Identity:32/157 - (20%)
Similarity:54/157 - (34%) Gaps:46/157 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LRKFEQLTDE------YKKINRFQKVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRA 95
            :.|.|:..:|      |.|:....:.....|.|.....:..|.....|..:..||...|.|:   
Zfish   243 VNKIEEFLEEVLAPPKYPKLAARHRESNAAGNDIFAKFSAFIKNTKPDANEALEKGLTKALK--- 304

  Fly    96 RVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFL 160
            ::||:|.                           .|.|:::.|  :.:|.......|      ||
Zfish   305 KLDEYLN---------------------------SPLPDEVDA--DSMEEEKASNRR------FL 334

  Fly   161 VGKNLTMAD--ILGSSEINQLRLCQYR 185
            .|.:||:||  :|....|.::...:||
Zfish   335 DGNDLTLADCNLLPKLHIVKVVAKKYR 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 9/48 (19%)
GstA 7..202 CDD:223698 32/157 (20%)
GST_C_family 93..218 CDD:295467 19/95 (20%)
clic5bNP_998062.1 GST_N_CLIC 170..259 CDD:239359 3/15 (20%)
O-ClC 172..407 CDD:129941 32/157 (20%)
GST_C_CLIC5 266..406 CDD:198330 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.