DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and gstt1b

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:209 Identity:73/209 - (34%)
Similarity:113/209 - (54%) Gaps:19/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSET 69
            :..|.||.|...|.::|..|.:|...:|..|:|.:..|..:|:.|||..:|.|.|..|||.|:|:
Zfish     3 LEIYLDLFSQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAES 67

  Fly    70 IAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRL--ACSMYFRDAWLFP--MNGIAPK 130
            :||:.|||||....:..:|..|:.||||:|:|.|||.:||:  |..::|:  .|.|  :....||
Zfish    68 VAIMIYLADKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFK--ILIPEVLGAEVPK 130

  Fly   131 PKPEQIQALIEGVENNLGLLERLW-----LENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKK 190
            .|       :|..|.||.:..:|:     .:..|:||..:::||::...||.|.......|.|.:
Zfish   131 EK-------MENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFENR 188

  Fly   191 FPKVVKWLERVRVS 204
             ||:..|.:||||:
Zfish   189 -PKLKAWKDRVRVA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 30/74 (41%)
GstA 7..202 CDD:223698 70/203 (34%)
GST_C_family 93..218 CDD:295467 40/121 (33%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 70/205 (34%)
GST_N_Theta 3..78 CDD:239348 30/74 (41%)
GST_C_Theta 91..217 CDD:198292 40/121 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12489
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4211
OMA 1 1.010 - - QHG54888
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - O PTHR43917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.