DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstO1

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:206 Identity:47/206 - (22%)
Similarity:79/206 - (38%) Gaps:63/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VEYCPIALRK--------------FEQLTDE---YKKINRFQKVPAI----VGGDFHLSETIAII 73
            :.:||.|.|.              :..|.|:   :..::...||||:    ..|:..|.|::.|.
  Fly    27 MRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLIESLIIC 91

  Fly    74 RYLADKGQFDEK-----LYPKTLENRARVDEFLE--WQHLNIRLACSMYFRDAWLFPMNGIAPKP 131
            .||      |||     ||||.|..:|:....:|  .|.:|     :.|:          :....
  Fly    92 DYL------DEKYPEVPLYPKDLLKKAQEKILIERFGQFIN-----AFYY----------LLLHD 135

  Fly   132 KPEQIQALIEGVENNLGLL---ERLWLE-NDFLVGKNLTMADILGSSEINQLRLCQYRVDEK--- 189
            .|||   |:: .::..||:   |.|... ..|..|.:..|.|.:......:....:|..::|   
  Fly   136 NPEQ---LVD-TDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFEL 196

  Fly   190 ---KFPKVVKW 197
               :||.::||
  Fly   197 SPERFPTLIKW 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 16/70 (23%)
GstA 7..202 CDD:223698 47/206 (23%)
GST_C_family 93..218 CDD:295467 23/117 (20%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 16/73 (22%)
GstA 22..216 CDD:223698 47/206 (23%)
GST_C_Omega 109..234 CDD:198293 23/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.