DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstO2

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:247 Identity:52/247 - (21%)
Similarity:95/247 - (38%) Gaps:68/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAI----VGGDFHL 66
            ||:.....|.:..  :.|..:...:|:..|.:...|: .:.||..:...||||:    |.....|
  Fly    24 RFFSMAFCPFSHR--VRLMLAAKHIEHHKIYVDLIEK-PEWYKDFSPLGKVPALQLTGVKDQPTL 85

  Fly    67 SETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPM---NGIA 128
            .|::.|..|| |:.....:|:|.....:| :|:.|..:...:..|         ::|:   |..|
  Fly    86 VESLIIAEYL-DQQYPQTRLFPTDPLQKA-LDKILIERFAPVVSA---------IYPVLTCNPNA 139

  Fly   129 PKPKPEQIQALIEGVENNLGLLERLWLE-----NDFLVGKNLTMADIL--------GSSEINQLR 180
            ||.       .|...||.|.:.|   :|     ..:..|:::.:.|.:        .|.:||..:
  Fly   140 PKD-------AIPNFENALDVFE---VELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQ 194

  Fly   181 LCQYRVDEKKFPKVVKW----------------------LERVRVSANPYHD 210
              :|.:|.|:|.|::||                      .::.:...||.:|
  Fly   195 --KYELDTKRFEKLLKWRDLMTQDEVVQKTALDVQLHAEFQKSKTLGNPQYD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 20/77 (26%)
GstA 7..202 CDD:223698 48/236 (20%)
GST_C_family 93..218 CDD:295467 30/156 (19%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 19/75 (25%)
GstA 25..215 CDD:223698 48/215 (22%)
GST_C_Omega 110..235 CDD:198293 27/146 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460036
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.