DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and se

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:214 Identity:48/214 - (22%)
Similarity:80/214 - (37%) Gaps:74/214 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VEYCPIALRK--------------FEQLTDEYKKI---NRFQKVPAI----VGGDFHLSETIAII 73
            :.:||.|.|.              :..|||:.:.:   |...||||:    ..|...|:|::.|.
  Fly    27 MRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVPALEIVREPGPPVLTESLLIC 91

  Fly    74 RYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPEQIQA 138
            .||      ||: ||                   :|   .:|.||    |:..:..|...|:.:|
  Fly    92 EYL------DEQ-YP-------------------LR---PLYPRD----PLKKVQDKLLIERFRA 123

  Fly   139 LIEGV--ENNLGLLERLWLEND------------FLVGKNLTMADILGSSEINQLRLCQ------ 183
            ::...  .::.|.||..|...|            |..|:...:.|.:......:|.|.:      
  Fly   124 VLGAFFKASDGGDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGED 188

  Fly   184 YRVDEKKFPKVVKWLERVR 202
            |..|:.:||::..||||::
  Fly   189 YNYDQSRFPQLTLWLERMK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 18/70 (26%)
GstA 7..202 CDD:223698 48/212 (23%)
GST_C_family 93..218 CDD:295467 26/130 (20%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 18/73 (25%)
GstA 22..215 CDD:223698 48/214 (22%)
GST_C_Omega 109..229 CDD:198293 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460033
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.