DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstO3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:225 Identity:52/225 - (23%)
Similarity:84/225 - (37%) Gaps:59/225 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRFYYDLLSPIARGLWIGLKFSNSPVEYCPIAL-RKFEQLTDEYKKINRFQKVPAI----VGGDF 64
            :|.|.....|.|:...:.|...|.|.....|.| .|.|.|.:    ::...||||:    ..|:.
  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVE----VSPLLKVPALQLVAEKGEP 82

  Fly    65 HLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAP 129
            .|.|::.|..||.||.. :..|.||....||: |:.|..:..:|..|.                 
  Fly    83 SLIESLIIAEYLDDKYP-ENPLLPKDPLKRAQ-DKILLERFSSITSAF----------------- 128

  Fly   130 KPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTM--ADILGSSE----------------I 176
                  |..|::|..     ||..|...| :..:.||.  ....|.::                :
  Fly   129 ------INILVQGTG-----LEDYWTALD-IFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSV 181

  Fly   177 NQLRL-CQYRVDEKKFPKVVKWLERVRVSA 205
            .:|:| .:|..:|.:|||:.||:..::..:
  Fly   182 IELKLQKEYNFNESRFPKITKWIALLKADS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 23/79 (29%)
GstA 7..202 CDD:223698 51/218 (23%)
GST_C_family 93..218 CDD:295467 25/132 (19%)
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 21/76 (28%)
GstA 22..209 CDD:223698 52/221 (24%)
GST_C_Omega 109..230 CDD:198293 25/133 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.