Sequence 1: | NP_724816.3 | Gene: | GstT2 / 246386 | FlyBaseID: | FBgn0050005 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_788432.1 | Gene: | Gr59f / 37726 | FlyBaseID: | FBgn0041234 | Length: | 406 | Species: | Drosophila melanogaster |
Alignment Length: | 257 | Identity: | 45/257 - (17%) |
---|---|---|---|
Similarity: | 71/257 - (27%) | Gaps: | 120/257 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 GLKFSNSPVEYCPIALRKFE-QLTDEYKKI--------------------------NRFQKVPAI 59
Fly 60 VGGDFHLS----------------------ETIAIIRYLADKGQFDEKLY--------------- 87
Fly 88 ---PKTLE-------NRA------RVDEFLEWQHLNIRL-ACSMYFRDAWL-------------- 121
Fly 122 FPMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVG--KNLTMADILGSSEINQLRL 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT2 | NP_724816.3 | GST_N_Theta | 5..80 | CDD:239348 | 20/106 (19%) |
GstA | 7..202 | CDD:223698 | 45/257 (18%) | ||
GST_C_family | 93..218 | CDD:295467 | 22/112 (20%) | ||
Gr59f | NP_788432.1 | 7tm_7 | 61..388 | CDD:303125 | 33/200 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |