DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and Gr59f

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:257 Identity:45/257 - (17%)
Similarity:71/257 - (27%) Gaps:120/257 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLKFSNSPVEYCPIALRKFE-QLTDEYKKI--------------------------NRFQKVPAI 59
            |.|..|||.|    .|..|. |..:.||::                          |||.::   
  Fly     8 GAKLKNSPRE----RLSSFNPQYAERYKELYRTLFWLLLISVLANTAPITILPGCPNRFYRL--- 65

  Fly    60 VGGDFHLS----------------------ETIAIIRYLADKGQFDEKLY--------------- 87
                .|||                      :.:::.|||   ...:..:|               
  Fly    66 ----VHLSWMILWYGLFVLGSYWEFVLVTTQRVSLDRYL---NAIESAIYVVHIFSIMLLTWQCR 123

  Fly    88 ---PKTLE-------NRA------RVDEFLEWQHLNIRL-ACSMYFRDAWL-------------- 121
               ||.:.       |||      |...|:..|...:.: ||...|.:.|.              
  Fly   124 NWAPKLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFACLAIFFNIWTHKFVVYRSILSINS 188

  Fly   122 FPMNGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVG--KNLTMADILGSSEINQLRL 181
            :.|..|.......|...|::|:         .|.:.....|  :.||.......||:.::|:
  Fly   189 YVMPNIISSISFAQYYLLLQGI---------AWRQRRLTEGLERELTHLHSPRISEVQKIRM 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 20/106 (19%)
GstA 7..202 CDD:223698 45/257 (18%)
GST_C_family 93..218 CDD:295467 22/112 (20%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 33/200 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.