DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstE11

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:241 Identity:62/241 - (25%)
Similarity:104/241 - (43%) Gaps:58/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPIRFYYD--------LLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPA 58
            :|||.:|..        ||:..|.||.:.|:..|         ::..|..:.|:.|:|....:|.
  Fly     3 AKPILYYAPRSPPCRAVLLTAAALGLELDLRLVN---------VKAGEHKSAEFLKLNAQHTIPV 58

  Fly    59 IVGGDFHLSETIAIIRYLADK--GQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWL 121
            :......:|::..|..|||||  .:.|:.||||..|.|..||             ..:|:....|
  Fly    59 LDDNGTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVD-------------ARLYYDCGHL 110

  Fly   122 FPM------------NGIAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSS 174
            ||.            .|..|..:...:|...:|:|:.|.       |.|:|||..||:||:...:
  Fly   111 FPRIRFIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLA-------EGDYLVGDKLTIADLSCIA 168

  Fly   175 EINQLRLCQYRVDEKKFPKVVKWLERVRVSANPYH----DEGLTFI 216
            .::...... .::..:||::|:|::|::  |.||:    .|||..:
  Fly   169 SVSTAEAFA-PIEPDQFPRLVQWVKRIQ--ALPYYQKNNQEGLDML 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 21/84 (25%)
GstA 7..202 CDD:223698 53/216 (25%)
GST_C_family 93..218 CDD:295467 33/140 (24%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 56/224 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 19/81 (23%)
GST_C_Delta_Epsilon 94..211 CDD:198287 34/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460096
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.