DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstE8

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:223 Identity:63/223 - (28%)
Similarity:94/223 - (42%) Gaps:35/223 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFH 65
            |||.| .|....||..|...:.|.....|.||..|.....|.|:.|:.:.|....||.:......
  Fly     1 MSKLI-LYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHF 64

  Fly    66 LSETIAIIRYLADK-GQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAP 129
            :.::.||..||..| ||.| .||||.|..||.||:             .::|....:| :||:..
  Fly    65 IWDSHAISAYLVSKYGQSD-TLYPKDLLQRAVVDQ-------------RLHFESGVVF-VNGLRG 114

  Fly   130 KPKP-----------EQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQ 183
            ..||           |:..|:||..:    .:|.....:||:.|..||:||....:.|..|.:..
  Fly   115 ITKPLFATGQTTIPKERYDAVIEIYD----FVETFLTGHDFIAGDQLTIADFSLITSITALAVFV 175

  Fly   184 YRVDEKKFPKVVKWLERVRVSANPYHDE 211
            . :|..|:..:..|::  |:...||::|
  Fly   176 V-IDTVKYANITAWIK--RIEELPYYEE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 21/75 (28%)
GstA 7..202 CDD:223698 55/206 (27%)
GST_C_family 93..218 CDD:295467 31/130 (24%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 57/214 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/73 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.