DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstE7

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:210 Identity:57/210 - (27%)
Similarity:94/210 - (44%) Gaps:32/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLA 77
            ||..|.:.:.|.....|.|:..:..|..|..::|:.|.|....||.:.....::.::.|||.||.
  Fly    12 SPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHAIIAYLV 76

  Fly    78 DKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKP--------- 133
            .|....:.||||.|..||.||:             .::|....:| .|.:....||         
  Fly    77 SKYGKTDSLYPKDLLQRAVVDQ-------------RLHFESGVIF-ANALRSITKPLFAGKQTMI 127

  Fly   134 --EQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVK 196
              |:..|:||..:    .||:....||::.|..||:||....|.::.|.:. .:||..|:|::..
  Fly   128 PKERYDAIIEVYD----FLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVF-VKVDTTKYPRIAA 187

  Fly   197 WLERVRVSANPYHDE 211
            |.:|::  ..||::|
  Fly   188 WFKRLQ--KLPYYEE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 18/66 (27%)
GstA 7..202 CDD:223698 54/199 (27%)
GST_C_family 93..218 CDD:295467 33/130 (25%)
GstE7NP_611329.1 GstA 4..196 CDD:223698 54/204 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/64 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460091
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.