DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstE6

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:205 Identity:56/205 - (27%)
Similarity:93/205 - (45%) Gaps:22/205 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLA 77
            ||..|.:.:.|...|...||..:.:....||:.||.:.|....||.:.....::.::.|||.||.
  Fly    12 SPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLV 76

  Fly    78 DKGQFDEKLYPKTLENRARVDEFLEWQH-----LNIR-LACSMYFRDAWLFPMNGIAPKPKPEQI 136
            .|....:.||||....||.||:.|.::.     ..|| ::.|:.|:        |....|| |:.
  Fly    77 SKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQ--------GQTKVPK-ERY 132

  Fly   137 QALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVKWLERV 201
            .|:||..:    .:|......|::.|..||:||....|.:..|. ....:|..|:|::..|::  
  Fly   133 DAIIEIYD----FVETFLKGQDYIAGNQLTIADFSLVSSVASLE-AFVALDTTKYPRIGAWIK-- 190

  Fly   202 RVSANPYHDE 211
            ::...||::|
  Fly   191 KLEQLPYYEE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 19/66 (29%)
GstA 7..202 CDD:223698 53/194 (27%)
GST_C_family 93..218 CDD:295467 32/125 (26%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 53/199 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/64 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460094
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.