DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstE4

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:206 Identity:57/206 - (27%)
Similarity:98/206 - (47%) Gaps:24/206 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLA 77
            ||..|...:.||..:.|.|:..:.|.:.|..::::.|.|....||.:...|..:.::.||:.||.
  Fly    12 SPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLV 76

  Fly    78 DKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAW-------LFPMNGIAPKPKPEQ 135
            :|....::||||.|..||:||:.:.::       ..:.|..|.       ||......|:.:.:.
  Fly    77 EKYAPSDELYPKDLLQRAKVDQLMHFE-------SGVIFESALRRLTRPVLFFGEPTLPRNQVDH 134

  Fly   136 IQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVKWLER 200
            |..:.:.||..|.       ::||:.|..||:||....|.|..:.:. ..:|..|:||:..||||
  Fly   135 ILQVYDFVETFLD-------DHDFVAGDQLTIADFSIVSTITSIGVF-LELDPAKYPKIAAWLER 191

  Fly   201 VRVSANPYHDE 211
            ::  ..||::|
  Fly   192 LK--ELPYYEE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 18/66 (27%)
GstA 7..202 CDD:223698 54/195 (28%)
GST_C_family 93..218 CDD:295467 33/126 (26%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 18/64 (28%)
GstA 6..196 CDD:223698 54/200 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/127 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.