DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstE3

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:225 Identity:74/225 - (32%)
Similarity:112/225 - (49%) Gaps:31/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLA 77
            ||..|.:.:.|:..|...:|..:.|.:.|.|..|:.|||....|||:....|:|:::.||..||.
  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76

  Fly    78 DKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPKPKPE-QIQALIE 141
            .|...::.||||.|:.||.||:.|   |.:..:..|.  ..|..||:........|: :|.|| |
  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRL---HYDSSVVTST--GRAITFPLFWENKTEIPQARIDAL-E 135

  Fly   142 GVENNLGLLERLWLEN-DFLVGKNLTMAD---ILGSSEINQLRLCQYRVDEKKFPKVVKWLERVR 202
            ||..:|    .|:||| ::|.|.|||:||   |.|.:..    .....||..|:|::..|::|::
  Fly   136 GVYKSL----NLFLENGNYLAGDNLTIADFHVIAGLTGF----FVFLPVDATKYPELAAWIKRIK 192

  Fly   203 VSANPYHDEG--------LTFIDRKSKQST 224
              ..||::|.        :.||  |||:.|
  Fly   193 --ELPYYEEANGSRAAQIIEFI--KSKKFT 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 22/66 (33%)
GstA 7..202 CDD:223698 65/193 (34%)
GST_C_family 93..218 CDD:295467 42/137 (31%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 65/198 (33%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/64 (34%)
GST_C_Delta_Epsilon 91..208 CDD:198287 40/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460087
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.