DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and clic4

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_958894.1 Gene:clic4 / 368255 ZFINID:ZDB-GENE-030326-3 Length:252 Species:Danio rerio


Alignment Length:252 Identity:57/252 - (22%)
Similarity:84/252 - (33%) Gaps:89/252 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRYLADKG------ 80
            |||..|.||      :..|.:...:.:.|           |:...|:.:.:|.:|  ||      
Zfish     9 GLKGDNEPV------IELFVKAGSDGESI-----------GNCPFSQRLFMILWL--KGVVFNVT 54

  Fly    81 QFDEKLYPKTLENRA-------------------RVDEFLE------------WQHLNIRLACSM 114
            ..|.|..|..|:|.|                   :::|:||            .:|.....|...
Zfish    55 TVDLKRKPADLQNLAPGTHPPFITFNGEVKTDVNKIEEYLEDILCPPKYSKLGARHPESNTAGMD 119

  Fly   115 YFRDAWLFPMNGIAPKPKPEQIQALIEGVENNLGLLER-----LWLEND-------------FLV 161
            .|.....|..|.     ||:..:||..|:...|..|:.     |..|.|             ||.
Zfish   120 IFAKFSAFIKNS-----KPDANEALERGLLKTLQKLDEYLCSPLPDEIDHNSMEEVKASTRMFLD 179

  Fly   162 GKNLTMAD--ILGSSEINQLRLCQYRVDEKKFPKVVK--WLERVRVSANPYHDEGLT 214
            |:.:|:||  :|....|.::...:||..|  .||.:.  |    |...|.|..|..|
Zfish   180 GEEMTLADCNLLPKLHIVKVVAKKYRGFE--IPKDLTGIW----RYLNNAYKREEFT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 12/57 (21%)
GstA 7..202 CDD:223698 52/238 (22%)
GST_C_family 93..218 CDD:295467 39/175 (22%)
clic4NP_958894.1 GST_N_CLIC 13..103 CDD:239359 20/108 (19%)
O-ClC 16..250 CDD:129941 53/245 (22%)
GST_C_CLIC4 110..250 CDD:198329 34/132 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.