DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT2 and GstE14

DIOPT Version :9

Sequence 1:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:203 Identity:64/203 - (31%)
Similarity:94/203 - (46%) Gaps:27/203 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLS 67
            ||| .|||..||..|...:.:|..:..||...:.|.|.||...::..:|....||.:|.||..|:
  Fly     5 KPI-LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLT 68

  Fly    68 ETIAIIRYLADKGQFDE--KLYPKTLENRARVDEFLEWQHLNIRL-ACSMYFRDAWLF----PMN 125
            ::.||:.:||:|  |||  .|:|:....|.:|        ||:.| .||..||....|    ...
  Fly    69 DSHAILIHLAEK--FDEGGSLWPQEHAERMKV--------LNLLLFECSFLFRRDSDFMSATVRQ 123

  Fly   126 GIAPKPKPEQIQALIEGVENNLGLLERLWLEN-DFLVGKNLTMADILGSSEINQLRLCQYRVDEK 189
            |.|........:.|.|...    ::|| :||| ||:.|..||:||:   |.:..|..........
  Fly   124 GFANVDVAHHERKLTEAYI----IMER-YLENSDFMAGPQLTLADL---SIVTTLSTVNLMFPLS 180

  Fly   190 KFPKVVKW 197
            :||::.:|
  Fly   181 QFPRLRRW 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 25/74 (34%)
GstA 7..202 CDD:223698 61/199 (31%)
GST_C_family 93..218 CDD:295467 31/111 (28%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 63/202 (31%)
GST_N_Delta_Epsilon 6..79 CDD:239343 25/73 (34%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
54.820

Return to query results.
Submit another query.